PAN Pesticides Database - Chemicals

Alkyl-1,3-propylene diamine acetate, alkyl derived from coconut oil fatty acids - Identification, toxicity, use, water pollution potential, ecological toxicity and regulatory information

Note: See Working with the Information on this Page section below for important notes about this data.

This website and underlying databases are maintained and updated by Pesticide Action Network North America (PAN). The project is made possible by our Sponsors and by PAN general funds. We need your support to maintain and improve this system. Please support the database and website — donate to PANNA.

Identifying information, including synonyms, ID numbers, use type, chemical classification, a link to a list of all products containing this chemical and a list of the top crops this pesticide is used on in California.
Signs and symptoms of poisoning, first aid, and links to treatment information for this chemical.
Link to information on toxicity to humans, including carcinogenicity, reproductive and developmental toxicity, neurotoxicity, and acute toxicity.
Links to world-wide registration status as well as regulatory information for the U.S. and California.
Water quality standards and physical properties affecting water contamination potential.
Toxicity to aquatic organisms.
List of chemicals in the same family, including breakdown products, salts, esters, isomers, and other derivatives.

Chemical Identification and Use for Alkyl-1,3-propylene diamine acetate, alkyl derived from coconut oil fatty acids

Basic Identification Information About This Chemical
Chemical Name: Alkyl-1,3-propylene diamine acetate, alkyl derived from coconut oil fatty acids
CAS Number: 61790-63-7
U.S. EPA PC Code:
CA DPR Chem Code: 1380
Molecular Weight: 0
Use Type: Microbiocide , Soap or Surfactant
Chem Class: Alkyl Amino Propane
View Related Chemicals
Additional Resources About This Chemical Class and Use Type
Other Names for this Chemical
About Chemical Synonyms
01380 (CA DPR Chem Code Text ) , 1380 (CA DPR Chem Code) ) , 61790-63-7 (CAS number) , 61790637 (CAS number without hyphens) , Alkyl-1,3-propylene diamine acetate, alkyl derived from coconut oil fatty acids , ALKYL-1,3-PROPYLENE DIAMINE ACETATES , ALKYL-1,3-PROPYLENEDIAMINE ACETATE ALKYL DERIVED FROM COCONUT OIL FATTY ACIDS , Alkyl13propylenediamineacetatealkylderivedfromcoconutoilfattyacids
Products Containing This Chemical
Current and historic U.S. registered products
View U.S. Products All Products Currently Registered Products

Signs and Symptoms of Alkyl-1,3-propylene diamine acetate, alkyl derived from coconut oil fatty acids Poisoning

NOTE! There may be other diseases and chemicals that have similar symptoms.

If you have a poisoning emergency in the United States call 1-800-222-1222.
If the victim has collapsed or is unconscious, call 911.

Sorry! No symptoms for this chemical or chemical group are available. See related chemicals for possible additional information.


Toxicity Information for Alkyl-1,3-propylene diamine acetate, alkyl derived from coconut oil fatty acids

  Note: Information for many chemicals is incomplete and may not be fully representative of effects on humans. Why?

Summary Toxicity Information

PAN Bad Actor
Carcinogen Cholinesterase
Water Contaminant
Developmental or
Reproductive Toxin
Not Listed
Indicates high toxicity in the given toxicological category. Indicates no available weight-of-the-evidence summary assessment. For additional information on toxicity from scientific journals or registration documents, see the "Additional Resources for Toxicity " section of the chemical detail page.
1. PAN Bad Actors are chemicals that are one or more of the following: highly acutely toxic, cholinesterase inhibitor, known/probable carcinogen, known groundwater pollutant or known reproductive or developmental toxicant. NOTE! Because there are no authoritative lists of Endocrine Disrupting (ED) chemicals, EDs are not yet considered PAN Bad Actor chemicals.
2. The acute toxicity reported on this page is of the pure chemical ingredient only and may not reflect the acute toxicity of individual pesticide products. To view acute toxicity of individual products, click on 'View Products' link in the 'Chemical Identification' section above.

Detailed Toxicity Information

Acute Toxicity 2
Alkyl-1,3-propylene diamine acetate, alkyl derived from coconut oil fatty acids
WHO Acute Hazard
TRI Acute Hazard
Material Safety Data Sheets
Acute rating from U.S. EPA product label
U.S. NTP Acute Toxicity Studies
      View Studies
Cholinesterase Inhibitor
Not Listed
Not Listed
Not Available
No Consensus Value
No NTP Studies

2. The acute toxicity reported on this page is of the pure chemical ingredient only and may not reflect the acute toxicity of individual pesticide products. To view acute toxicity of individual products, click on 'View Products' link in the 'Chemical Identification' section above.
Cancer Information
Alkyl-1,3-propylene diamine acetate, alkyl derived from coconut oil fatty acids
IARC Carcinogens
U.S. NTP Carcinogens
California Prop 65 Known Carcinogens
U.S. EPA Carcinogens
TRI Carcinogen
Not Listed
Not Listed
Not Listed
Not Listed
Not Listed
Endocrine Disruption
Alkyl-1,3-propylene diamine acetate, alkyl derived from coconut oil fatty acids
Illinois EPA list
Keith list
Colborn list
Benbrook list
Danish Inert list
EU list
Not Listed
Not Listed
Not Listed
Not Listed
Not Listed
Not Listed
Reproductive and Developmental Toxicity
Alkyl-1,3-propylene diamine acetate, alkyl derived from coconut oil fatty acids
CA Prop 65 Developmental Toxin
U.S. TRI Developmental Toxin
CA Prop 65 Female Reproductive Toxin
CA Prop 65 Male Reproductive Toxin
U.S. TRI Reproductive Toxin
Not Listed
Not Listed
Not Listed
Not Listed
Not Listed
Chemicals of Special Concern
Alkyl-1,3-propylene diamine acetate, alkyl derived from coconut oil fatty acids
PAN Bad Actors
PAN Dirty Dozen list
Not Listed
Not Listed

Water Pollution Potential and Criteria for Alkyl-1,3-propylene diamine acetate, alkyl derived from coconut oil fatty acids

Water Pollution Potential

PAN Ground Water Contaminant Rating Insufficient Data

Sorry, no water quality standards or criteria have been established for this chemical by the U.S. or Canadian governments; however, there may be criteria established for related chemicals.


Regulatory Information for Alkyl-1,3-propylene diamine acetate, alkyl derived from coconut oil fatty acids

International Regulatory Status

UNEP Persistent Organic Pollutant (POP)
UNEP Prior Informed Consent Chemical (PIC)
WHO Obsolete Pesticide
Not Listed
Not Listed
Not Listed

U.S. and California Regulatory Status

U.S. EPA Registered
U.S. EPA Hazardous Air Pollutant
U.S. EPA Minimum Risk Pesticide (25b list)

CA Registered
CA Groundwater Contaminant
CA Toxic Air Contaminant
Not Listed

Not Listed
Not Listed

Maximum Tolerance and Residue Levels

Codex Alimentarius
   (UN FAO Maximum Residue Limits)
U.S. Maximum Tolerance Levels
European Union Maximum Residue Levels
Go to web site

Go to web site

Go to web site

Ecotoxicity for Alkyl-1,3-propylene diamine acetate, alkyl derived from coconut oil fatty acids

Note! Information for many chemicals is incomplete and may not be fully representative of effects on the environment. Why? Click on underlined terms for definitions and additional information.

Aquatic Ecotoxicity

All Toxic Effects for Organism Group
Organism Group Effects Noted

No effects noted for this chemical. Try related chemicals.

Summary of Acute Toxicity for Organism Group

Sorry, no acute aquatic ecotoxicity data available for this chemical. Try related chemicals.


Terrestrial Ecotoxicity

Summary of Acute Toxicity for Organism Group

Sorry, no honeybee acute toxicity data available for this chemical. Try related chemicals.

Note: Population-level effects on honeybees may occur even if a pesticide has low acute toxicity. For example, certain pesticides interfere with honeybee reproduction, ability to navigate, or temperature regulation, any of which can have an effect on long-term survival of honeybee colonies. The neonicotinoids, pyrethroids and keto-enol pesticides are some types of pesticides causing one or more of these effects.
Honeybee Chronic Toxicity
Organism Group Chronic Toxicity  

Related Chemicals for Alkyl-1,3-propylene diamine acetate, alkyl derived from coconut oil fatty acids

CAS Number Relation Reason Chemical Name Chem Detail Symptoms California Use Chem Use Type U.S. EPA Reg PAN Bad Actor
61790-63-7 Parent P Alkyl-1,3-propylene diamine acetate, alkyl derived from coconut oil fatty acids View View View Microbiocide, Soap or Surfactant Yes Not Listed
68526-65-8 Related 2 Alkyl*-diamine monobenzoate *(as in fatty acids of coconut oil) View View View Microbiocide, Adjuvant No Not Listed
Related 2 Alkyl-1,3-propylene diamine, alkyl derived from coconut oil fatty acids View View View Microbiocide, Soap or Surfactant No Not Listed
Related 2 Mixed fatty alkyl* diamines *(42%C12, 26%C18, 15%C14, 8%C16, 5%C10, 4%C8) View View View Microbiocide No Not Listed
68188-29-4 Related 2 N-Alkyl-1,3-propylene diamine monobenzoate, alkyl derived from coconut oil fatty acids View View View Microbiocide, Soap or Surfactant No Not Listed
68856-30-4 Related 2 N-cis-9-Octadecenyl-1,3-propylenediamine diacetate View View View Microbiocide No Not Listed
Working with the Information on this Page

Click on underlined terms for definitions or go to the Pesticide Tutorial overview page.

Any underlined term with a book icon has additional information.

* Data marked with an asterisk indicates that this chemical is not explicitly listed on the corresponding list. Instead, it belongs to a group of chemicals that IS designated on the list. For example, if an agency assigns a classification of reproductive toxicant to "mercury compounds", that classification is applied to all mercury compounds in the PAN Pesticide database, which are then marked with an asterisk.

To print this page, choose Print. To export this data, choose Save As 'HTML Source' and open it in Excel or equivalent program.